XA5 T2AG_ORYSJ TFIIAy TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity (By similarity). Protein involved in the resistance to X.oryzae. MATFELYRRSTIGMCLTETLDEMVSSGTLSPELAIQVLVQFDKSMTEALENQVKSKVSIKGHLHTYRFCDNVWTFILTEASFKNEETTEQVGKVKIVACDSKLLSQ General transcription factor IIA subunit 2 Transcription initiation factor IIA gamma chain 106 LOC_Os05g01710 Os05g0107700 Transcription initiation factor IIA subunit 2 OSJNBa0068N01.8